Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries) |
Domain d4ez9d1: 4ez9 D:298-468 [251831] Other proteins in same PDB: d4ez9a2, d4ez9d2 automated match to d3pv8d1 protein/DNA complex; complexed with d3t, mpd, so4 |
PDB Entry: 4ez9 (more details), 1.64 Å
SCOPe Domain Sequences for d4ez9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ez9d1 c.55.3.0 (D:298-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]} kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d4ez9d1: