Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries) |
Domain d4egbh_: 4egb H: [251750] automated match to d2hunb_ complexed with nad, ni, so4, suc |
PDB Entry: 4egb (more details), 3 Å
SCOPe Domain Sequences for d4egbh_:
Sequence, based on SEQRES records: (download)
>d4egbh_ c.2.1.0 (H:) automated matches {Bacillus anthracis [TaxId: 198094]} amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge iqngellehvikerdvqvivnfaaeshvdrsienpipfydtnvigtvtllelvkkyphik lvqvstdevygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsn nygpyqypekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevy niggnnektnvevveqiitllgktkkdieyvtdrlghdrryainaekmknefdwepkytf eqglqetvqwyekneewwkplk
>d4egbh_ c.2.1.0 (H:) automated matches {Bacillus anthracis [TaxId: 198094]} amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge iqngellehvikerdvqvivnfaaeshipfydtnvigtvtllelvkkyphiklvqvstde vygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqyp ekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnek tnvevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwye kneewwkplk
Timeline for d4egbh_: