Lineage for d4egbc_ (4egb C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580213Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries)
  8. 1580222Domain d4egbc_: 4egb C: [251745]
    automated match to d2hunb_
    complexed with nad, ni, so4, suc

Details for d4egbc_

PDB Entry: 4egb (more details), 3 Å

PDB Description: 3.0 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad
PDB Compounds: (C:) dtdp-glucose 4,6-dehydratase

SCOPe Domain Sequences for d4egbc_:

Sequence, based on SEQRES records: (download)

>d4egbc_ c.2.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 198094]}
amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
iqngellehvikerdvqvivnfaaeshvdrsienpipfydtnvigtvtllelvkkyphik
lvqvstdevygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsn
nygpyqypekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevy
niggnnektnvevveqiitllgktkkdieyvtdrlghdrryainaekmknefdwepkytf
eqglqetvqwyekneewwkplk

Sequence, based on observed residues (ATOM records): (download)

>d4egbc_ c.2.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 198094]}
amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
nvevveqiitllgktkkdieyvtdhdrryainaekmknefdwepkytfeqglqetvqwye
kneewwkplk

SCOPe Domain Coordinates for d4egbc_:

Click to download the PDB-style file with coordinates for d4egbc_.
(The format of our PDB-style files is described here.)

Timeline for d4egbc_: