Lineage for d4eb8c_ (4eb8 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496449Protein automated matches [190142] (20 species)
    not a true protein
  7. 2496506Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries)
  8. 2496518Domain d4eb8c_: 4eb8 C: [251721]
    Other proteins in same PDB: d4eb8a2, d4eb8b2
    automated match to d1ulba_
    complexed with edo, im5, po4; mutant

Details for d4eb8c_

PDB Entry: 4eb8 (more details), 2.3 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase (W16Y, W94Y, W178Y, H257W) mutant from human complexed with DADMe-ImmG and phosphate
PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4eb8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eb8c_ c.56.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvpg
hagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnpk
fevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmge
qrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslitn
kvimdyeslekanweevlaagkqaaqkleqfvsilmasiplpd

SCOPe Domain Coordinates for d4eb8c_:

Click to download the PDB-style file with coordinates for d4eb8c_.
(The format of our PDB-style files is described here.)

Timeline for d4eb8c_: