Lineage for d4e5ib_ (4e5i B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604623Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 1604624Protein PA N-terminal domain [254375] (3 species)
  7. 1604639Species Influenza A virus [TaxId:93838] [254808] (13 PDB entries)
  8. 1604688Domain d4e5ib_: 4e5i B: [251682]
    automated match to d3ebja_
    complexed with 0n9, mn, so4

Details for d4e5ib_

PDB Entry: 4e5i (more details), 2.94 Å

PDB Description: crystal structure of avian influenza virus pan bound to compound 4
PDB Compounds: (B:) Polymerase protein PA

SCOPe Domain Sequences for d4e5ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e5ib_ c.52.1.34 (B:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa

SCOPe Domain Coordinates for d4e5ib_:

Click to download the PDB-style file with coordinates for d4e5ib_.
(The format of our PDB-style files is described here.)

Timeline for d4e5ib_: