Lineage for d4e02a1 (4e02 A:40-185)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488345Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1488380Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 1488381Protein automated matches [230679] (2 species)
    not a true protein
  7. 1488395Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries)
  8. 1488398Domain d4e02a1: 4e02 A:40-185 [251642]
    Other proteins in same PDB: d4e02a2
    automated match to d3tz0a1
    complexed with anp, k, mg, wj1

Details for d4e02a1

PDB Entry: 4e02 (more details), 2.15 Å

PDB Description: Crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/(S)-2-chloro-3-phenylpropanoic acid complex with AMPPNP
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4e02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e02a1 a.29.5.0 (A:40-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhely
irafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvryf
ldktltsrlgirmlathhlalhedkp

SCOPe Domain Coordinates for d4e02a1:

Click to download the PDB-style file with coordinates for d4e02a1.
(The format of our PDB-style files is described here.)

Timeline for d4e02a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e02a2