| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) ![]() automatically mapped to Pfam PF10436 |
| Family a.29.5.0: automated matches [230678] (1 protein) not a true family |
| Protein automated matches [230679] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries) |
| Domain d3tz0a1: 3tz0 A:38-185 [233754] Other proteins in same PDB: d3tz0a2 automated match to d1gkza1 complexed with 03h |
PDB Entry: 3tz0 (more details), 2.5 Å
SCOPe Domain Sequences for d3tz0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tz0a1 a.29.5.0 (A:38-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgirmlathhlalhedkp
Timeline for d3tz0a1: