Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d4duwa5: 4duw A:731-1023 [251590] Other proteins in same PDB: d4duwa1, d4duwa2, d4duwa3, d4duwa4, d4duwb1, d4duwb2, d4duwb3, d4duwb4, d4duwc1, d4duwc2, d4duwc3, d4duwc4, d4duwd1, d4duwd2, d4duwd3, d4duwd4 automated match to d1jz8a4 complexed with dms, lak, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwa5 b.30.5.0 (A:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d4duwa5:
View in 3D Domains from same chain: (mouse over for more information) d4duwa1, d4duwa2, d4duwa3, d4duwa4 |