Lineage for d4duwa5 (4duw A:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391761Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2391798Domain d4duwa5: 4duw A:731-1023 [251590]
    Other proteins in same PDB: d4duwa1, d4duwa2, d4duwa3, d4duwa4, d4duwb1, d4duwb2, d4duwb3, d4duwb4, d4duwc1, d4duwc2, d4duwc3, d4duwc4, d4duwd1, d4duwd2, d4duwd3, d4duwd4
    automated match to d1jz8a4
    complexed with dms, lak, mg, na

Details for d4duwa5

PDB Entry: 4duw (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) in complex with allolactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4duwa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duwa5 b.30.5.0 (A:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d4duwa5:

Click to download the PDB-style file with coordinates for d4duwa5.
(The format of our PDB-style files is described here.)

Timeline for d4duwa5: