| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (16 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
| Domain d4duwb4: 4duw B:626-730 [251594] Other proteins in same PDB: d4duwa1, d4duwa3, d4duwa5, d4duwb1, d4duwb3, d4duwb5, d4duwc1, d4duwc3, d4duwc5, d4duwd1, d4duwd3, d4duwd5 automated match to d1jz8a2 complexed with dms, lak, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwb4 b.1.4.0 (B:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d4duwb4:
View in 3DDomains from same chain: (mouse over for more information) d4duwb1, d4duwb2, d4duwb3, d4duwb5 |