SCOPe 2.08: Domain d4bqwa_: 4bqw A:

Lineage for d4bqwa_ (4bqw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
   Pfam PF13640; PubMed 16782814

6. Protein automated matches [254532] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255179] (35 PDB entries)

8. Domain d4bqwa_: 4bqw A: [251309]
   automated match to d2g19a_
   protein/DNA complex; complexed with mn, qnm

Details for d4bqwa_

PDB Entry: 4bqw, 1.79 Å

PDB Description: hif prolyl hydroxylase 2 (phd2/ egln1) in complex with mn(ii) and 2- (4-hydroxy-2-oxo-1,2-dihydroquinoline-3-carboxamido)acetic acid

PDB Compounds: (A:) Egl nine homolog 1

SCOPe Domain Sequences for d4bqwa_:

Sequence; same for both SEQRES and ATOM records:

>d4bqwa_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds
skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgng
tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw
sdrrnphevqpayatryaitvwyfdaderarakvky

Timeline for d4bqwa_:

• d4bqwa_ first appeared in SCOPe 2.04
  
• d4bqwa_ appears in SCOPe 2.07