Lineage for d1ptoh1 (1pto H:90-199)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110116Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 110272Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
  7. 110273Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 110284Domain d1ptoh1: 1pto H:90-199 [25126]
    Other proteins in same PDB: d1ptoa_, d1ptob2, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh2, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_

Details for d1ptoh1

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptoh1 b.40.2.1 (H:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

SCOP Domain Coordinates for d1ptoh1:

Click to download the PDB-style file with coordinates for d1ptoh1.
(The format of our PDB-style files is described here.)

Timeline for d1ptoh1: