SCOP 1.57: Domain d1ptoh1: 1pto H:90-199

Lineage for d1ptoh1 (1pto H:90-199)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)

8. Domain d1ptoh1: 1pto H:90-199 [25126]
   Other proteins in same PDB: d1ptoa_, d1ptob2, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh2, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_

Details for d1ptoh1

PDB Entry: 1pto, 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptoh1:

Sequence; same for both SEQRES and ATOM records:

>d1ptoh1 b.40.2.1 (H:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

Timeline for d1ptoh1:

• d1ptoh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ptoh1 appears in SCOP 1.59
  
• d1ptoh1 appears in the current release, SCOPe 2.08