Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (23 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [256193] (1 PDB entry) |
Domain d4axoa_: 4axo A: [251167] Other proteins in same PDB: d4axob2 automated match to d2pytb_ complexed with mg |
PDB Entry: 4axo (more details), 1 Å
SCOPe Domain Sequences for d4axoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4axoa_ b.82.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} dtvdfvrnkdisgitsiklptvkvsesdrldtgnpsdvvytkdlftleesprlgcgmmem kettfdwtlnydeidyvidgtldiiidgrkvsassgelifipkgskiqfsvpdyarfiyv typadw
Timeline for d4axoa_: