SCOPe 2.06: Domain d4axob1: 4axo B:29-157

Lineage for d4axob1 (4axo B:29-157)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (23 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [256193] (1 PDB entry)

8. Domain d4axob1: 4axo B:29-157 [251168]
   Other proteins in same PDB: d4axob2
   automated match to d2pytb_
   complexed with mg

Details for d4axob1

PDB Entry: 4axo, 1 Å

PDB Description: structure of the clostridium difficile eutq protein

PDB Compounds: (B:) ethanolamine utilization protein

SCOPe Domain Sequences for d4axob1:

Sequence; same for both SEQRES and ATOM records:

>d4axob1 b.82.1.0 (B:29-157) automated matches {Clostridium difficile [TaxId: 272563]}
tvdfvrnkdisgitsiklptvkvsesdrldtgnpsdvvytkdlftleesprlgcgmmemk
ettfdwtlnydeidyvidgtldiiidgrkvsassgelifipkgskiqfsvpdyarfiyvt
ypadwasqn

Timeline for d4axob1:

• d4axob1 first appeared in SCOPe 2.04, called d4axob_
  
• d4axob1 was called d4axob_ in SCOPe 2.05
  
• d4axob1 appears in SCOPe 2.07
  
• d4axob1 appears in the current release, SCOPe 2.08