SCOPe 2.04: Domain d4av7c2: 4av7 C:539-663

Lineage for d4av7c2 (4av7 C:539-663)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.0: automated matches [191568] (1 protein)
   not a true family

6. Protein automated matches [190987] (3 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries)

8. Domain d4av7c2: 4av7 C:539-663 [251152]
   Other proteins in same PDB: d4av7a1, d4av7b1, d4av7c1, d4av7d1, d4av7e1, d4av7f1
   automated match to d4axha2
   complexed with so4, zn; mutant

Details for d4av7c2

PDB Entry: 4av7, 3 Å

PDB Description: Structure determination of the double mutant S233Y F250G from the sec- alkyl sulfatase PisA1

PDB Compounds: (C:) sec-alkylsulfatase

SCOPe Domain Sequences for d4av7c2:

Sequence; same for both SEQRES and ATOM records:

>d4av7c2 d.106.1.0 (C:539-663) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
veleh

Timeline for d4av7c2:

• d4av7c2 is new in SCOPe 2.04-stable
  
• d4av7c2 appears in SCOPe 2.05
  
• d4av7c2 appears in the current release, SCOPe 2.08