Lineage for d4axha2 (4axh A:539-660)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664171Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 1664172Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 1664228Family d.106.1.0: automated matches [191568] (1 protein)
    not a true family
  6. 1664229Protein automated matches [190987] (3 species)
    not a true protein
  7. 1664230Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries)
  8. 1664237Domain d4axha2: 4axh A:539-660 [219192]
    Other proteins in same PDB: d4axha1, d4axhb1
    automated match to d2cfua1
    complexed with so4, zn

Details for d4axha2

PDB Entry: 4axh (more details), 2.7 Å

PDB Description: structure and mechanism of the first inverting alkylsulfatase specific for secondary alkylsulfatases
PDB Compounds: (A:) sec-alkylsulfatase

SCOPe Domain Sequences for d4axha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4axha2 d.106.1.0 (A:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
ve

SCOPe Domain Coordinates for d4axha2:

Click to download the PDB-style file with coordinates for d4axha2.
(The format of our PDB-style files is described here.)

Timeline for d4axha2:

1664237
d4axha2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4axha1