Lineage for d2cfua1 (2cfu A:530-655)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.106: SCP-like [55717] (1 superfamily)
alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145Superfamily d.106.1: SCP-like [55718] (5 families) 
Family d.106.1.3: Alkylsulfatase C-terminal domain-like [160617] (1 protein) Protein Alkylsulfatase SdsA1 [160618] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [160619] (4 PDB entries)
Uniprot Q9I5I9 530-655
Domain d2cfua1: 2cfu A:530-655 [146386]
Other proteins in same PDB: d2cfua2
complexed with 1db, ipa, peg, zn
Details for d2cfua1
PDB Entry: 2cfu (more details), 1.9 Å
PDB Description: crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with 1-decane-sulfonic-acid.
PDB Compounds: (A:) sdsa1SCOPe Domain Sequences for d2cfua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfua1 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]}
gsadalaamdtgllfdylgvrldagaaegkalsinlrlpdigenyllelknshlnnlrgv
qsedagqtvsidradlnrlllkevsavrlvfegklkssgnplllgqlfgmlgdfdfwfdi
vtpaak
SCOPe Domain Coordinates for d2cfua1:
Click to download the PDB-style file with coordinates for d2cfua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cfua1:
- d2cfua1 first appeared in SCOP 1.75
- d2cfua1 appears in SCOPe 2.03
- d2cfua1 appears in SCOPe 2.05
- d2cfua1 appears in the current release, SCOPe 2.08
View in 3D
