Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) |
Family d.106.1.3: Alkylsulfatase C-terminal domain-like [160617] (1 protein) |
Protein Alkylsulfatase SdsA1 [160618] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [160619] (6 PDB entries) Uniprot Q9I5I9 530-655 |
Domain d2cfua1: 2cfu A:530-655 [146386] Other proteins in same PDB: d2cfua2 complexed with 1db, ipa, peg, zn |
PDB Entry: 2cfu (more details), 1.9 Å
SCOPe Domain Sequences for d2cfua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfua1 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} gsadalaamdtgllfdylgvrldagaaegkalsinlrlpdigenyllelknshlnnlrgv qsedagqtvsidradlnrlllkevsavrlvfegklkssgnplllgqlfgmlgdfdfwfdi vtpaak
Timeline for d2cfua1: