Lineage for d2cfua1 (2cfu A:530-655)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968281Family d.106.1.3: Alkylsulfatase C-terminal domain-like [160617] (1 protein)
  6. 2968282Protein Alkylsulfatase SdsA1 [160618] (1 species)
  7. 2968283Species Pseudomonas aeruginosa [TaxId:287] [160619] (6 PDB entries)
    Uniprot Q9I5I9 530-655
  8. 2968284Domain d2cfua1: 2cfu A:530-655 [146386]
    Other proteins in same PDB: d2cfua2
    complexed with 1db, ipa, peg, zn

Details for d2cfua1

PDB Entry: 2cfu (more details), 1.9 Å

PDB Description: crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with 1-decane-sulfonic-acid.
PDB Compounds: (A:) sdsa1

SCOPe Domain Sequences for d2cfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfua1 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]}
gsadalaamdtgllfdylgvrldagaaegkalsinlrlpdigenyllelknshlnnlrgv
qsedagqtvsidradlnrlllkevsavrlvfegklkssgnplllgqlfgmlgdfdfwfdi
vtpaak

SCOPe Domain Coordinates for d2cfua1:

Click to download the PDB-style file with coordinates for d2cfua1.
(The format of our PDB-style files is described here.)

Timeline for d2cfua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cfua2