SCOPe 2.07: Domain d4anua2: 4anu A:357-522

Lineage for d4anua2 (4anu A:357-522)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries)

8. Domain d4anua2: 4anu A:357-522 [251080]
   Other proteins in same PDB: d4anua1, d4anua3, d4anua4, d4anua5
   automated match to d1e8wa2
   complexed with em7, so4

Details for d4anua2

PDB Entry: 4anu, 2.81 Å

PDB Description: Complexes of PI3Kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anua2:

Sequence, based on SEQRES records:

>d4anua2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records):

>d4anua2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsat
npdkensmsisilldn

Timeline for d4anua2:

• d4anua2 first appeared in SCOPe 2.04
  
• d4anua2 appears in SCOPe 2.06
  
• d4anua2 appears in the current release, SCOPe 2.08