Lineage for d1czgd_ (1czg D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110116Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 110308Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 110309Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 110378Domain d1czgd_: 1czg D: [25098]

Details for d1czgd_

PDB Entry: 1czg (more details), 2.5 Å

PDB Description: structure of the g62t mutant of shiga-like toxin i b subunit

SCOP Domain Sequences for d1czgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czgd_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

SCOP Domain Coordinates for d1czgd_:

Click to download the PDB-style file with coordinates for d1czgd_.
(The format of our PDB-style files is described here.)

Timeline for d1czgd_: