| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) |
| Domain d4a4ha_: 4a4h A: [250923] automated match to d2d9ta1 protein/RNA complex; complexed with da2 |
PDB Entry: 4a4h (more details)
SCOPe Domain Sequences for d4a4ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a4ha_ b.34.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astqpthswkvgdkcmavwsedgqcyeaeieeideengtaaitfagygnaevtpllnlkp
veeg
Timeline for d4a4ha_: