Lineage for d4a4ha_ (4a4h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784818Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2784897Domain d4a4ha_: 4a4h A: [250923]
    automated match to d2d9ta1
    protein/RNA complex; complexed with da2

Details for d4a4ha_

PDB Entry: 4a4h (more details)

PDB Description: Solution structure of SPF30 Tudor domain in complex with asymmetrically dimethylated arginine
PDB Compounds: (A:) survival of motor neuron-related-splicing factor 30

SCOPe Domain Sequences for d4a4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a4ha_ b.34.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astqpthswkvgdkcmavwsedgqcyeaeieeideengtaaitfagygnaevtpllnlkp
veeg

SCOPe Domain Coordinates for d4a4ha_:

Click to download the PDB-style file with coordinates for d4a4ha_.
(The format of our PDB-style files is described here.)

Timeline for d4a4ha_: