Lineage for d3zg5a2 (3zg5 A:139-327)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684037Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 1684038Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 1684066Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 1684067Protein automated matches [226981] (7 species)
    not a true protein
  7. 1684097Species Staphylococcus aureus [TaxId:1280] [256159] (3 PDB entries)
  8. 1684098Domain d3zg5a2: 3zg5 A:139-327 [250786]
    Other proteins in same PDB: d3zg5a1, d3zg5a3, d3zg5b1, d3zg5b3
    automated match to d1vqqa2
    complexed with cd, cl

Details for d3zg5a2

PDB Entry: 3zg5 (more details), 2.55 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with peptidoglycan analogue at allosteric
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zg5a2 d.175.1.0 (A:139-327) automated matches {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d3zg5a2:

Click to download the PDB-style file with coordinates for d3zg5a2.
(The format of our PDB-style files is described here.)

Timeline for d3zg5a2: