SCOPe 2.08: Domain d3zg0b2: 3zg0 B:139-327

Lineage for d3zg0b2 (3zg0 B:139-327)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256156] (6 PDB entries)

8. Domain d3zg0b2: 3zg0 B:139-327 [250783]
   Other proteins in same PDB: d3zg0a1, d3zg0a3, d3zg0b1, d3zg0b3
   automated match to d1vqqa2
   complexed with 1w8, ai8, cd, cl, mur

Details for d3zg0b2

PDB Entry: 3zg0, 2.6 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by cocrystallization

PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg0b2:

Sequence; same for both SEQRES and ATOM records:

>d3zg0b2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d3zg0b2:

• d3zg0b2 first appeared in SCOPe 2.04
  
• d3zg0b2 appears in SCOPe 2.07