Lineage for d3zg0a2 (3zg0 A:139-327)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004598Species Staphylococcus aureus [TaxId:158878] [256156] (6 PDB entries)
  8. 3004607Domain d3zg0a2: 3zg0 A:139-327 [250780]
    Other proteins in same PDB: d3zg0a1, d3zg0a3, d3zg0b1, d3zg0b3
    automated match to d1vqqa2
    complexed with 1w8, ai8, cd, cl, mur

Details for d3zg0a2

PDB Entry: 3zg0 (more details), 2.6 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by cocrystallization
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zg0a2 d.175.1.0 (A:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d3zg0a2:

Click to download the PDB-style file with coordinates for d3zg0a2.
(The format of our PDB-style files is described here.)

Timeline for d3zg0a2: