SCOPe 2.08: Domain d3zg0a1: 3zg0 A:27-138

Lineage for d3zg0a1 (3zg0 A:27-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256155] (6 PDB entries)

8. Domain d3zg0a1: 3zg0 A:27-138 [250779]
   Other proteins in same PDB: d3zg0a2, d3zg0a3, d3zg0b2, d3zg0b3
   automated match to d1vqqa1
   complexed with 1w8, ai8, cd, cl, mur

Details for d3zg0a1

PDB Entry: 3zg0, 2.6 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by cocrystallization

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg0a1:

Sequence; same for both SEQRES and ATOM records:

>d3zg0a1 d.17.4.0 (A:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d3zg0a1:

• d3zg0a1 first appeared in SCOPe 2.04
  
• d3zg0a1 appears in SCOPe 2.07