Lineage for d3zg0a1 (3zg0 A:27-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937309Species Staphylococcus aureus [TaxId:158878] [256155] (6 PDB entries)
  8. 2937318Domain d3zg0a1: 3zg0 A:27-138 [250779]
    Other proteins in same PDB: d3zg0a2, d3zg0a3, d3zg0b2, d3zg0b3
    automated match to d1vqqa1
    complexed with 1w8, ai8, cd, cl, mur

Details for d3zg0a1

PDB Entry: 3zg0 (more details), 2.6 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by cocrystallization
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zg0a1 d.17.4.0 (A:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d3zg0a1:

Click to download the PDB-style file with coordinates for d3zg0a1.
(The format of our PDB-style files is described here.)

Timeline for d3zg0a1: