SCOPe 2.04: Domain d3zfza2: 3zfz A:139-327

Lineage for d3zfza2 (3zfz A:139-327)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256156] (3 PDB entries)

8. Domain d3zfza2: 3zfz A:139-327 [250774]
   Other proteins in same PDB: d3zfza1, d3zfza3, d3zfzb1, d3zfzb3
   automated match to d1vqqa2
   complexed with 1w8, ai8, cd, cl, mur

Details for d3zfza2

PDB Entry: 3zfz, 2.25 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by soaking

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zfza2:

Sequence; same for both SEQRES and ATOM records:

>d3zfza2 d.175.1.0 (A:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d3zfza2:

• d3zfza2 is new in SCOPe 2.04-stable
  
• d3zfza2 appears in SCOPe 2.05
  
• d3zfza2 appears in the current release, SCOPe 2.08