| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) ![]() automatically mapped to Pfam PF03717 |
| Family d.175.1.0: automated matches [227232] (1 protein) not a true family |
| Protein automated matches [226981] (7 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [256156] (3 PDB entries) |
| Domain d3zfza2: 3zfz A:139-327 [250774] Other proteins in same PDB: d3zfza1, d3zfza3, d3zfzb1, d3zfzb3 automated match to d1vqqa2 complexed with 1w8, ai8, cd, cl, mur |
PDB Entry: 3zfz (more details), 2.25 Å
SCOPe Domain Sequences for d3zfza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zfza2 d.175.1.0 (A:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt
Timeline for d3zfza2: