Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [254875] (2 PDB entries) |
Domain d3zdtb3: 3zdt B:254-362 [250761] Other proteins in same PDB: d3zdtb1, d3zdtb2 automated match to d2al6a2 mutant |
PDB Entry: 3zdt (more details), 3.15 Å
SCOPe Domain Sequences for d3zdtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zdtb3 b.55.1.0 (B:254-362) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirp
Timeline for d3zdtb3: