SCOPe 2.06: Domain d3zdtb3: 3zdt B:254-362

Lineage for d3zdtb3 (3zdt B:254-362)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [254875] (2 PDB entries)

8. Domain d3zdtb3: 3zdt B:254-362 [250761]
   Other proteins in same PDB: d3zdtb1, d3zdtb2
   automated match to d2al6a2
   mutant

Details for d3zdtb3

PDB Entry: 3zdt, 3.15 Å

PDB Description: crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a

PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3zdtb3:

Sequence; same for both SEQRES and ATOM records:

>d3zdtb3 b.55.1.0 (B:254-362) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirp

Timeline for d3zdtb3:

• d3zdtb3 first appeared in SCOPe 2.04
  
• d3zdtb3 appears in SCOPe 2.05
  
• d3zdtb3 appears in SCOPe 2.07
  
• d3zdtb3 appears in the current release, SCOPe 2.08