Lineage for d3zdtb3 (3zdt B:254-362)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803778Species Chicken (Gallus gallus) [TaxId:9031] [254875] (2 PDB entries)
  8. 2803779Domain d3zdtb3: 3zdt B:254-362 [250761]
    Other proteins in same PDB: d3zdtb1, d3zdtb2
    automated match to d2al6a2
    mutant

Details for d3zdtb3

PDB Entry: 3zdt (more details), 3.15 Å

PDB Description: crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3zdtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zdtb3 b.55.1.0 (B:254-362) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirp

SCOPe Domain Coordinates for d3zdtb3:

Click to download the PDB-style file with coordinates for d3zdtb3.
(The format of our PDB-style files is described here.)

Timeline for d3zdtb3: