![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [254874] (2 PDB entries) |
![]() | Domain d3zdtb2: 3zdt B:131-253 [250760] Other proteins in same PDB: d3zdtb1, d3zdtb3 automated match to d2al6a1 mutant |
PDB Entry: 3zdt (more details), 3.15 Å
SCOPe Domain Sequences for d3zdtb2:
Sequence, based on SEQRES records: (download)
>d3zdtb2 a.11.2.0 (B:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek ksnyevlekdvglrrffpkslldsvaaatlaaliqqtfrqfanlnreesilkffeilspv yrf
>d3zdtb2 a.11.2.0 (B:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsysnyevlekdv glrrffpkslldsvaaatlaaliqqtfrqfanlnreesilkffeilspvyrf
Timeline for d3zdtb2: