Lineage for d3zdtb2 (3zdt B:131-253)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697547Species Chicken (Gallus gallus) [TaxId:9031] [254874] (2 PDB entries)
  8. 2697548Domain d3zdtb2: 3zdt B:131-253 [250760]
    Other proteins in same PDB: d3zdtb1, d3zdtb3
    automated match to d2al6a1
    mutant

Details for d3zdtb2

PDB Entry: 3zdt (more details), 3.15 Å

PDB Description: crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3zdtb2:

Sequence, based on SEQRES records: (download)

>d3zdtb2 a.11.2.0 (B:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvaaatlaaliqqtfrqfanlnreesilkffeilspv
yrf

Sequence, based on observed residues (ATOM records): (download)

>d3zdtb2 a.11.2.0 (B:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsysnyevlekdv
glrrffpkslldsvaaatlaaliqqtfrqfanlnreesilkffeilspvyrf

SCOPe Domain Coordinates for d3zdtb2:

Click to download the PDB-style file with coordinates for d3zdtb2.
(The format of our PDB-style files is described here.)

Timeline for d3zdtb2: