SCOPe 2.07: Domain d3vfqa1: 3vfq A:791-974

Lineage for d3vfqa1 (3vfq A:791-974)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256134] (4 PDB entries)

8. Domain d3vfqa1: 3vfq A:791-974 [250540]
   automated match to d2dx6a_
   complexed with ar6

Details for d3vfqa1

PDB Entry: 3vfq, 2.8 Å

PDB Description: human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphoribose

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 14

SCOPe Domain Sequences for d3vfqa1:

Sequence; same for both SEQRES and ATOM records:

>d3vfqa1 c.50.1.0 (A:791-974) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kcfsrtvlapgvvlivqqgdlarlpvdvvvnasnedlkhygglaaalskaagpelqadcd
qivkregrllpgnatiskagklpyhhvihavgprwsgyeaprcvyllrravqlslclaek
ykyrsiaipaissgvfgfplgrcvetivsaikenfqfkkdghclkeiylvdvsektveaf
aeav

Timeline for d3vfqa1:

• d3vfqa1 first appeared in SCOPe 2.04
  
• d3vfqa1 appears in SCOPe 2.06
  
• d3vfqa1 appears in the current release, SCOPe 2.08