Lineage for d3vdba2 (3vdb A:220-333)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036363Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2036364Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2036378Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2036467Domain d3vdba2: 3vdb A:220-333 [250479]
    Other proteins in same PDB: d3vdba1, d3vdba3, d3vdba5, d3vdbb1, d3vdbb3, d3vdbb5, d3vdbc1, d3vdbc3, d3vdbc5, d3vdbd1, d3vdbd3, d3vdbd5
    automated match to d1jz8a1
    complexed with 149, dms, mg, na

Details for d3vdba2

PDB Entry: 3vdb (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t) in complex with galactonolactone
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3vdba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdba2 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3vdba2:

Click to download the PDB-style file with coordinates for d3vdba2.
(The format of our PDB-style files is described here.)

Timeline for d3vdba2: