Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d3vdba2: 3vdb A:220-333 [250479] Other proteins in same PDB: d3vdba1, d3vdba3, d3vdba5, d3vdbb1, d3vdbb3, d3vdbb5, d3vdbc1, d3vdbc3, d3vdbc5, d3vdbd1, d3vdbd3, d3vdbd5 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3vdb (more details), 2.05 Å
SCOPe Domain Sequences for d3vdba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdba2 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3vdba2:
View in 3D Domains from same chain: (mouse over for more information) d3vdba1, d3vdba3, d3vdba4, d3vdba5 |