| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
| Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
| Domain d1jz8a1: 1jz8 A:220-333 [67830] Other proteins in same PDB: d1jz8a3, d1jz8a4, d1jz8a5, d1jz8b3, d1jz8b4, d1jz8b5, d1jz8c3, d1jz8c4, d1jz8c5, d1jz8d3, d1jz8d4, d1jz8d5 complexed with dms, lak, mg, na, tar |
PDB Entry: 1jz8 (more details), 1.5 Å
SCOPe Domain Sequences for d1jz8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz8a1 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jz8a1:
View in 3DDomains from same chain: (mouse over for more information) d1jz8a2, d1jz8a3, d1jz8a4, d1jz8a5 |