![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3vdba1: 3vdb A:9-219 [250478] Other proteins in same PDB: d3vdba2, d3vdba3, d3vdba4, d3vdba5, d3vdbb2, d3vdbb3, d3vdbb4, d3vdbb5, d3vdbc2, d3vdbc3, d3vdbc4, d3vdbc5, d3vdbd2, d3vdbd3, d3vdbd4, d3vdbd5 automated match to d1f49a3 complexed with 149, dms, mg, na |
PDB Entry: 3vdb (more details), 2.05 Å
SCOPe Domain Sequences for d3vdba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdba1 b.18.1.5 (A:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3vdba1:
![]() Domains from same chain: (mouse over for more information) d3vdba2, d3vdba3, d3vdba4, d3vdba5 |