| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
| Protein beta-Galactosidase, domain 5 [49996] (2 species) |
| Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
| Domain d3vdbb5: 3vdb B:731-1023 [250487] Other proteins in same PDB: d3vdba1, d3vdba2, d3vdba3, d3vdba4, d3vdbb1, d3vdbb2, d3vdbb3, d3vdbb4, d3vdbc1, d3vdbc2, d3vdbc3, d3vdbc4, d3vdbd1, d3vdbd2, d3vdbd3, d3vdbd4 automated match to d1jz8a4 complexed with 149, dms, mg, na |
PDB Entry: 3vdb (more details), 2.05 Å
SCOPe Domain Sequences for d3vdbb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdbb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3vdbb5:
View in 3DDomains from same chain: (mouse over for more information) d3vdbb1, d3vdbb2, d3vdbb3, d3vdbb4 |