Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
Species Escherichia coli [TaxId:562] [50211] (17 PDB entries) |
Domain d1qoha_: 1qoh A: [25035] A mutant shiga-like toxin IIe mutant |
PDB Entry: 1qoh (more details), 2.35 Å
SCOPe Domain Sequences for d1qoha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoha_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs gfaevqfn
Timeline for d1qoha_: