Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d3v4pn1: 3v4p N:1-113 [250306] Other proteins in same PDB: d3v4pl2, d3v4pn2 automated match to d2jell1 complexed with 15p, ca, mg, nag, trs |
PDB Entry: 3v4p (more details), 3.15 Å
SCOPe Domain Sequences for d3v4pn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4pn1 b.1.1.1 (N:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvvvtqtplslpvsfgdqvsiscrssqslaksygntylswylhkpgqspqlliygisnrf sgvpdrfsgsgsgtdftlkistikpedlgmyyclqgthqpytfgggtkleikr
Timeline for d3v4pn1: