Lineage for d3v4pn1 (3v4p N:1-113)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2020405Domain d3v4pn1: 3v4p N:1-113 [250306]
    Other proteins in same PDB: d3v4pl2, d3v4pn2
    automated match to d2jell1
    complexed with 15p, ca, mg, nag, trs

Details for d3v4pn1

PDB Entry: 3v4p (more details), 3.15 Å

PDB Description: crystal structure of a4b7 headpiece complexed with Fab ACT-1
PDB Compounds: (N:) MONOCLONAL ANTIBODY Act-1 LIGHT CHAIN

SCOPe Domain Sequences for d3v4pn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4pn1 b.1.1.1 (N:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvvtqtplslpvsfgdqvsiscrssqslaksygntylswylhkpgqspqlliygisnrf
sgvpdrfsgsgsgtdftlkistikpedlgmyyclqgthqpytfgggtkleikr

SCOPe Domain Coordinates for d3v4pn1:

Click to download the PDB-style file with coordinates for d3v4pn1.
(The format of our PDB-style files is described here.)

Timeline for d3v4pn1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v4pn2