Lineage for d3ul6b_ (3ul6 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2543035Species Saccharum officinarum [TaxId:4547] [256120] (2 PDB entries)
  8. 2543041Domain d3ul6b_: 3ul6 B: [250231]
    automated match to d3imad_
    complexed with pe4

Details for d3ul6b_

PDB Entry: 3ul6 (more details), 2.63 Å

PDB Description: Saccharum officinarum canecystatin-1 in space group P6422
PDB Compounds: (B:) Canecystatin-1

SCOPe Domain Sequences for d3ul6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ul6b_ d.17.1.0 (B:) automated matches {Saccharum officinarum [TaxId: 4547]}
endleaielarfavaehnsktnamleferlvkvrhqvvagtmhhftvqvkeagggkklye
akvwekvwenfkqlqsfqpv

SCOPe Domain Coordinates for d3ul6b_:

Click to download the PDB-style file with coordinates for d3ul6b_.
(The format of our PDB-style files is described here.)

Timeline for d3ul6b_: