SCOPe 2.08: Domain d3ul6b_: 3ul6 B:

Lineage for d3ul6b_ (3ul6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (13 species)
   not a true protein

7. Species Saccharum officinarum [TaxId:4547] [256120] (2 PDB entries)

8. Domain d3ul6b_: 3ul6 B: [250231]
   automated match to d3imad_
   complexed with pe4

Details for d3ul6b_

PDB Entry: 3ul6, 2.63 Å

PDB Description: Saccharum officinarum canecystatin-1 in space group P6422

PDB Compounds: (B:) Canecystatin-1

SCOPe Domain Sequences for d3ul6b_:

Sequence; same for both SEQRES and ATOM records:

>d3ul6b_ d.17.1.0 (B:) automated matches {Saccharum officinarum [TaxId: 4547]}
endleaielarfavaehnsktnamleferlvkvrhqvvagtmhhftvqvkeagggkklye
akvwekvwenfkqlqsfqpv

Timeline for d3ul6b_:

• d3ul6b_ first appeared in SCOPe 2.04
  
• d3ul6b_ appears in SCOPe 2.07