Lineage for d3ubxa1 (3ubx A:6-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938968Domain d3ubxa1: 3ubx A:6-185 [250187]
    Other proteins in same PDB: d3ubxa2, d3ubxa3, d3ubxb_, d3ubxd2, d3ubxd3, d3ubxe_, d3ubxg_, d3ubxh_, d3ubxi1, d3ubxi2, d3ubxl1, d3ubxl2
    automated match to d3hujc1
    complexed with 09n, nag

Details for d3ubxa1

PDB Entry: 3ubx (more details), 3.1 Å

PDB Description: crystal structure of the mouse cd1d-c20:2-agalcer-l363 mab fab complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3ubxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubxa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3ubxa1:

Click to download the PDB-style file with coordinates for d3ubxa1.
(The format of our PDB-style files is described here.)

Timeline for d3ubxa1: