Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d3ubxd1: 3ubx D:6-185 [250190] Other proteins in same PDB: d3ubxa2, d3ubxa3, d3ubxb_, d3ubxd2, d3ubxd3, d3ubxe_, d3ubxg_, d3ubxh_, d3ubxi1, d3ubxi2, d3ubxl1, d3ubxl2 automated match to d3hujc1 complexed with 09n, nag |
PDB Entry: 3ubx (more details), 3.1 Å
SCOPe Domain Sequences for d3ubxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubxd1 d.19.1.0 (D:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3ubxd1: