SCOPe 2.07: Domain d3u82a_: 3u82 A:

Lineage for d3u82a_ (3u82 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human herpesvirus 1 [TaxId:10299] [256116] (1 PDB entry)

8. Domain d3u82a_: 3u82 A: [250148]
   automated match to d1jmaa_

Details for d3u82a_

PDB Entry: 3u82, 3.16 Å

PDB Description: Binding of herpes simplex virus glycoprotein D to nectin-1 exploits host cell adhesion

PDB Compounds: (A:) Envelope glycoprotein D

SCOPe Domain Sequences for d3u82a_:

Sequence; same for both SEQRES and ATOM records:

>d3u82a_ b.1.1.1 (A:) automated matches {Human herpesvirus 1 [TaxId: 10299]}
pvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllnapseapqivr
gasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqprwnyydsfs
avsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyalplrippsac
lspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll

Timeline for d3u82a_:

• d3u82a_ first appeared in SCOPe 2.04
  
• d3u82a_ appears in SCOPe 2.06
  
• d3u82a_ appears in the current release, SCOPe 2.08