Lineage for d3u82a_ (3u82 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743664Species Human herpesvirus 1 [TaxId:10299] [256116] (1 PDB entry)
  8. 2743665Domain d3u82a_: 3u82 A: [250148]
    automated match to d1jmaa_

Details for d3u82a_

PDB Entry: 3u82 (more details), 3.16 Å

PDB Description: Binding of herpes simplex virus glycoprotein D to nectin-1 exploits host cell adhesion
PDB Compounds: (A:) Envelope glycoprotein D

SCOPe Domain Sequences for d3u82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u82a_ b.1.1.1 (A:) automated matches {Human herpesvirus 1 [TaxId: 10299]}
pvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllnapseapqivr
gasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqprwnyydsfs
avsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyalplrippsac
lspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll

SCOPe Domain Coordinates for d3u82a_:

Click to download the PDB-style file with coordinates for d3u82a_.
(The format of our PDB-style files is described here.)

Timeline for d3u82a_: