SCOPe 2.04: Domain d1c4qe_: 1c4q E:

Lineage for d1c4qe_ (1c4q E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (14 PDB entries)

8. Domain d1c4qe_: 1c4q E: [25014]

Details for d1c4qe_

PDB Entry: 1c4q, 1.52 Å

PDB Description: mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue

PDB Compounds: (E:) protein (shiga-like toxin I subunit b)

SCOPe Domain Sequences for d1c4qe_:

Sequence; same for both SEQRES and ATOM records:

>d1c4qe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d1c4qe_:

• d1c4qe_ first appeared (with stable ids) in SCOP 1.55
  
• d1c4qe_ appears in SCOPe 2.03
  
• d1c4qe_ appears in SCOPe 2.05
  
• d1c4qe_ appears in the current release, SCOPe 2.08