Lineage for d1c4qe_ (1c4q E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13820Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 13821Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 13826Domain d1c4qe_: 1c4q E: [25014]

Details for d1c4qe_

PDB Entry: 1c4q (more details), 1.52 Å

PDB Description: mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue

SCOP Domain Sequences for d1c4qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4qe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1c4qe_:

Click to download the PDB-style file with coordinates for d1c4qe_.
(The format of our PDB-style files is described here.)

Timeline for d1c4qe_: