Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3tzvh1: 3tzv H:2-118 [250058] Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2 automated match to d3q5ya1 complexed with d12, fuc, gol, hex, lsc, nag |
PDB Entry: 3tzv (more details), 3.06 Å
SCOPe Domain Sequences for d3tzvh1:
Sequence, based on SEQRES records: (download)
>d3tzvh1 b.1.1.0 (H:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls sestvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle
>d3tzvh1 b.1.1.0 (H:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekglss estvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle
Timeline for d3tzvh1: