Lineage for d3tzvh1 (3tzv H:2-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758466Domain d3tzvh1: 3tzv H:2-118 [250058]
    Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2
    automated match to d3q5ya1
    complexed with d12, gol, hex, lsc

Details for d3tzvh1

PDB Entry: 3tzv (more details), 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine
PDB Compounds: (H:) Invariant Natural Killer T Cell Receptor chain B

SCOPe Domain Sequences for d3tzvh1:

Sequence, based on SEQRES records: (download)

>d3tzvh1 b.1.1.0 (H:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
sestvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle

Sequence, based on observed residues (ATOM records): (download)

>d3tzvh1 b.1.1.0 (H:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekglss
estvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle

SCOPe Domain Coordinates for d3tzvh1:

Click to download the PDB-style file with coordinates for d3tzvh1.
(The format of our PDB-style files is described here.)

Timeline for d3tzvh1: