SCOPe 2.04: Domain d3tyya_: 3tyy A:

Lineage for d3tyya_ (3tyy A:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families)

5. Family h.1.20.0: automated matches [254316] (1 protein)
   not a true family

6. Protein automated matches [254726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256106] (1 PDB entry)

8. Domain d3tyya_: 3tyy A: [250041]
   automated match to d1gk4a_

Details for d3tyya_

PDB Entry: 3tyy, 2.4 Å

PDB Description: crystal structure of human lamin-b1 coil 2 segment

PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d3tyya_:

Sequence; same for both SEQRES and ATOM records:

>d3tyya_ h.1.20.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkesracleriqeledllakekdnsrrmltdkeremaeirdqmqqqlndyeqlldvklal
dmeisayrkllegee

Timeline for d3tyya_:

• d3tyya_ is new in SCOPe 2.04-stable
  
• d3tyya_ appears in SCOPe 2.05
  
• d3tyya_ appears in the current release, SCOPe 2.08