Lineage for d3tyya_ (3tyy A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040442Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) (S)
  5. 3040462Family h.1.20.0: automated matches [254316] (1 protein)
    not a true family
  6. 3040463Protein automated matches [254726] (1 species)
    not a true protein
  7. 3040464Species Human (Homo sapiens) [TaxId:9606] [256106] (6 PDB entries)
  8. 3040471Domain d3tyya_: 3tyy A: [250041]
    automated match to d1gk4a_

Details for d3tyya_

PDB Entry: 3tyy (more details), 2.4 Å

PDB Description: crystal structure of human lamin-b1 coil 2 segment
PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d3tyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyya_ h.1.20.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkesracleriqeledllakekdnsrrmltdkeremaeirdqmqqqlndyeqlldvklal
dmeisayrkllegee

SCOPe Domain Coordinates for d3tyya_:

Click to download the PDB-style file with coordinates for d3tyya_.
(The format of our PDB-style files is described here.)

Timeline for d3tyya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3tyyb_