![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) ![]() |
![]() | Family h.1.20.0: automated matches [254316] (1 protein) not a true family |
![]() | Protein automated matches [254726] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256106] (6 PDB entries) |
![]() | Domain d3tyya_: 3tyy A: [250041] automated match to d1gk4a_ |
PDB Entry: 3tyy (more details), 2.4 Å
SCOPe Domain Sequences for d3tyya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyya_ h.1.20.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkesracleriqeledllakekdnsrrmltdkeremaeirdqmqqqlndyeqlldvklal dmeisayrkllegee
Timeline for d3tyya_: